@jeffw to politics • 5 months agoMore food, less regulation: Project 2025’s vision for agriculturewww.salon.comexternal-linkmessage-square23arrow-up1125arrow-down14
arrow-up1121arrow-down1external-linkMore food, less regulation: Project 2025’s vision for agriculturewww.salon.com@jeffw to politics • 5 months agomessage-square23
minus-squarerhythmisaprancerlinkfedilink1•5 months agoThere used to be a screw on tuna cans. Still is, but used to, too.
minus-square@rayyylink3•5 months agoSoylent green, just grind up homeless people. High protein, low cost - win,win.
More “food”
They mean more screws in tuna cans.
There used to be a screw on tuna cans. Still is, but used to, too.
Soylent green, just grind up homeless people. High protein, low cost - win,win.